WE ARE WATER.

Ob wir aus Wasser Wein machen können? Nein. Denn wir arbeiten auf einer rein physikalisch-wissenschaftlichen Basis. Was wir hingegen können: Sämtliche Fremd- und Schadstoffe aus Ihrem Trinkwasser "eliminieren". Ihrem Verbrauchswasser "Stressfaktoren" für Körper, Haushalt und Garten zu entziehen und das Agrarwasser so aufzubereiten, dass der Einsatz von chemischen Sprühmitteln überflüssig wird. 
EVOadsorb
Effektive und nachhaltige Filtration für das gesamte Haus. Das Herzstück des EVOadsorb ist das Adsorbationsmaterial, welches Ihr Wasser von Schwermetallen, Antibiotika, Chemikalien und Mikroorganismen befreit. Um auch das Kalk- und Korrosionsproblem zu lösen, haben wir zusätzlich ein Anti-Scale-Modul integriert. Dieses inaktiviert die Bindungsfähigkeit der Kationen und Anionen im Kalk und in den Schwermetallen. Dadurch kann sich der Kalk im Wasser nicht mehr bilden und auf Oberflächen haften bleiben. Zusätzlich verhindern wir die Korrosion durch Schwermetalle im Wasser. Folglich schützt der EVOadsorb Ihre Rohrleitungen im Haus und damit auch alle wasserführenden Geräte vor Verstopfung oder Verschleiss und sorgt für gesundes und sauberes Trink-, wie auch Verbrauchswasser. Der EVOadsorb ist die optimale Ergänzung zum EVOtransform und ergänzt ihn um eine effektive Schadstoffentfernung. Unser EVOadsorb bietet Ihnen optimale Schadstoffentfernung und löst Ihre Kalkprobleme. Bei besonders hartem Wasser, wie es in einigen Teilen der Schweiz vorkommt, empfehlen wir Ihnen allerdings den EVOdescale, da dieser noch stärker auf die effektive Kalkentfernung ausgerichtet ist. Wenden Sie sich doch an uns, um mit uns die perfekte Lösung für Ihr Zuhause zu besprechen. PDF download

2.200,00 CHF*
EVOtransform
Die zeitgemässe Antwort auf herkömmliche Enthärtungsanlagen. In diesem rein physikalischen Wasseraufbereitungssystem wird das Wasser mit rund 100’000 Umdrehungen pro Minute rotiert. Diese Rotationskraft sorgt dafür, dass sich die Kalkkristalle im Wasser verkleinern und abstumpfen. Somit entsteht eine amorphe Struktur und die ionisierten Kalzium- und Magnesium-Moleküle (Kalk) können im Wasser keine feste Verbindungen mehr eingehen. Folglich lösen sich alte Kalkablagerungen und Sie schützen Ihre Rohrleitungen im Haus und damit auch alle wasserführenden Geräte vor Verstopfung oder Verschleiss durch Kalk. Dank der enormen Energie der Rotation verselbständigen sich die verklumpten Wassermoleküle und das Wasser wird samtig weich. Für eine optimale Kalkentfernung empfehlen wir die Kombination mit unserem EVOdescale oder EVOadsorb. PDF download

1.200,00 CHF*
EVOpool
Sollte schwimmen und plantschen nicht einfach nur Spass machen? Vermeiden Sie den Einsatz von Chemikalien wie Chlor oder Brom. Setzen Sie auf ein umweltfreundliches Wasseraufbereitungssystem, das den Wasserverbrauch reduziert und beim Badespass Haut, Haare und Atemwege nicht nur schont, sondern pflegt. Mit unserem Wasseraufbereitungssystem für Schwimmbäder wird das Wasser gereinigt, Schadstoffe werden entfernt und Gerüche neutralisiert. Bakterien und Viren werden abgetötet, das Wasser naturalisiert und mit Kolloiden angereichert. Das Ergebnis: kristallklares, sauerstoffreiches, hautfreundliches und gesundes Wasser. Übrigens: Bei den Kolloiden handelt es sich um reine, nicht ionisierte Atome. Diese kommen dem Menschen zugute, indem sie das Sauerstoff-Stoffwechsel-Enzym von Pilzen, Bakterien, Viren oder anderen einzelligen Krankheitserregern deaktivieren. Zudem werden keine nützlichen Enzyme zerstört, wie es bei pharmazeutischen Antibiotika der Fall ist. Unser EVOpool kann individuell auf Ihre benötigte Wassermenge angepasst werden. Deswegen empfehlen wir Ihnen, sich vor der Bestellung an uns zu wenden, damit wir Sie optimal beraten können. PDF download

9.500,00 CHF*
EVObooster
Wasserstoff – ein kleines Atom mit grossen Kräften. Der EVObooster reichert das Wasser mit molekularem Wasserstoff an. Nach dem Trinken wird das farb- und geruchlose Wasserstoffgas im gesamten Körper verteilt. Da Wasserstoff das kleinste Element im Periodensystem ist, dringt es in jede Zelle vor und wirkt als stärkstes selektives und natürliches Antioxidans. Mit Wasserstoff angereichertes Wasser ist für einen gesunden Körper und Geist unabdingbar. Mit dem EVObooster setzen wir auf eine elektrophysikalische Aufbereitung und reichern das Wasser mit molekularem Wasserstoff an. Er stellt somit die ideale Ergänzung zu unserem EVOfilter dar.PDF download

1.300,00 CHF*
EVOfilter
Der weltweit einzige Wasserfilter, der nachweislich 614 Fremd- und Schadstoffe «eliminiert». Reiner geht’s nicht. Dank unserer Ultra-Nano-Membran ist der EVOfilter kostengünstiger und umweltschonender als vergleichbare Filtermethoden. Dank winziger elektronenmikroskopischer Durchlassstellen von nur 0.9 Nanometer können Stoffe im molekularen Bereich ausgefiltert werden und die Membranen haben im Vergleich zu herkömmlichen Produkten eine bis zu dreifach höhere Lebensdauer und sparen bis zu 50% Energie und Wasser ein. Mit unserem EVOfilter geniessen Sie bestmögliche Wasserqualität - ohne jegliche Schad- oder Fremdstoffe.  Mit dem EVOfilter profitieren Sie nicht nur von bester Qualität, Ihr Wasser ist auch günstiger als jedes Flaschenwasser. Unser EVOfilter lässt sich hervorragend kombinieren mit unserem EVObooster. PDF download

2.900,00 CHF*
EVOdrink (Kunststoff)
Entweder Sie haben einen Filter oder Sie sind selbst der Filter! Ob Mikroplastik, Pestizide oder Medikamentenrückstände. Ob Schwermetalle, Chlor oder Viren. Entweder beschäftigt sich Ihr Körper mit den Schadstoffen oder aber Sie überlassen das unserem Filter. Der EVOdrink verbessert spürbar den Geschmack Ihres Trinkwassers, garantiert keimfreien Trinkgenuss dank einem patentierten Verfahren und zeichnet sich durch kostengünstige Anschaffung und Unterhalt aus. Der EVOdrink ist in einer Edelstahl- oder Kunststoffversion erhältlich und kann optional mit der Trinkwasserveredelung EVOcharge ausgerüstet werden.Mit unserem EVOdrink geniessen Sie garantiert schadstofffreies Wasser. Im Unterschied zum EVOfilter bleiben hier allerdings Mineralien im Wasser enthalten. PDF download

490,00 CHF*
EVOagri
Kann die Landwirtschaft rein physikalisch ihre Erträge steigern? Ja. Sie kann… Mit dem Wasseraufbereitungssystem EVOagri kann jeder Landwirt ab sofort komplett auf den Einsatz von Pestiziden, Fungiziden, Bakteriziden auf den Feldern und auf Antibiotika in den Ställen verzichten. Zudem können bis zu 20% Wasser und Düngemittel eingespart werden. Nach Jahren intensiver Forschung haben wir ein innovatives Verfahren zur Wasseraufbereitung und -anreicherung entwickelt, welches den natürlichen Zustand des Bodens wiederherstellt. Dabei wird die Oberflächenspannung des Wassers reduziert und die Leitfähigkeit und Löslichkeit erhöht. Dadurch kann der Boden besser durchdrungen und mehr Wasser gespeichert werden. Zudem werden Mikroorganismen im Boden gefördert. Unser EVOagri kann individuell auf Ihre benötigte Wassermenge angepasst werden. Deswegen empfehlen wir Ihnen, sich vor der Bestellung an uns zu wenden, damit wir Sie optimal beraten können. PDF download

9.500,00 CHF*